Sunday, September 4, 2016

It was 2 o'clock in the morning when I awoke with a start and realized that there is an "active learning classroom" that can accommodate all of my 125 General Microbiology students. I was just able to make out the writing in my memory, the writing on the wall of the foyer of the new Enzi STEM Building: Capacity 164.
With a rush of excitement, I also recalled that the huge, naturally lit foyer is lined with glass writing boards. Zealous with enthusiasm, I began developing a Flashback Flipped Friday lesson plan. A 30 minute vodcast covers the basics of macromolecule structure https://youtu.be/6aKEuXdMwck. I opt for calling it Flashback because I draw everything (modeling the building of knowledge structures through multimodal approaches) - no PowerPoint Slides. I create a set of critical thought questions that ask students to also draw on the glass boards using the knowledge that they gained from the vodcast (assignment below).
And when the Friday comes, I am literally shaking with anticipation. We all gather near the south doors! I welcome all of my students and realize that my TAs have also come as have my GAs and then I realize, there is Bethann and a huge handful of other students who took my class semesters before. It is as if there is a carnival in town. And there is! I hand out dry erase pens, erasures, the active learning exercises. Student groups disperse as if a drop of oil has pushed their water loving bodies to the room's periphery; not a glass board is unused. The energy is off the charts as I run from one group to another, asking questions, helping with drawings and being literally "blown away" by the sexy minds that I encounter.
Later that day, as I talked with one of my students in office hours, he said, "Rachel, I felt like I was allowed to learn". And, perhaps, there is nothing that I can say further to champion the value of this active learning day.
We will return to the STEM foyer for our next Friday Flashback and Flip Day on September 16th!


Friday Flashback and Flip Day (September 2nd, 2016)
    1. PROTEINS
    Proteins have many functions. Please make a drawing of three different things that proteins do within cells.

For Amanda: Luffin P-1 is an antimicrobial peptide made by plants (specifically a particular Gourd). Luffin P-1 has been shown to have anti-HIV-1 activity (Pharmaceuticals, 2015, vol 8 and J. Struct. Biol. 2011, 174, 164–172)
The sequence of the peptide is below:
GSPRTEYEACRVRCQVAEHGVEPRRQRRCQQVCEKRLREREGRRE
2)    Please draw the structure of the most common amino acid in Luffin P-1.
3)    Please examine the amino acids in Luffin P-1. Circle the basic amino acids; put a square around the acidic amino acids. Is Luffin P-1 overall acidic or basic?
4)    If you know that Luffin P-1 is comprised of primarily alpha-helix and no beta-strands, please try to draw the overall secondary and tertiary structure of this amazing peptide. Please label the amino and carboxyl termini and note which amino acids are there. Please also try to hypothesize (and label) the location of at least three other amino acids in the above sequence.
5)    Would Luffin P-1 be ‘happy’ dissolved in water? (Answer this question by using an approach such as that you used in #3).
6)    Luffin P-1 does not have quaternary structure. Try drawing a protein that has quaternary structure.
7)    In the drawing that you made of the protein with quaternary structure in #6 (above), find an alpha helix that has one side that faces the inside of the protein and one side that faces the outside. This type of alpha-helix is called an amphipathic alpha helix (this means it is a helix with a ‘dual nature’!) Pick out one amino acid that would be each side of the dual natured alpha helix.

II.             CARBOHYDRATES
1)    Draw a molecule of glucose. On your picture, show the way in which one –OH on glucose would interact with one molecule of water.
2)    Draw a second molecule of glucose and show what would happen if it were linked to the first molecule of glucose. What molecule is lost and what is the name of the resulting bond.
3)    Both cellulose and glycogen are polysaccharides composed of glucose subunits. Some microorganisms can use cellulose as a food source but humans cannot. Why? What does this have to do with ruminants?

III.           NUCLEIC ACIDS
1)    Draw the full structure of the following short fragment of DNA. 5’GCTAC3’.
2)    How would you know that the above molecule was DNA if you hadn’t been told?
3)    Label the purines and pyrimidines in your DNA drawing.
4)    Label the 3’-5’ phosphodiester bonds in your DNA drawing.
5)    What would change if the molecule you drew was RNA and not DNA? Why is DNA and not RNA, the molecule of life?

IV.           LIPIDS
1)    Draw a phospholipid
2)    Label the nonpolar (hydrophobic tails) on your phospholipid; label the polar head group.
3)    Note the location on this molecule that would differ if it were a TAG instead of a phospholipid.
4)    Show a drawing that indicates how your drawn phospholipid would fit into a biological membrane.

Finally, be sure that you label the repeating subunits in your drawing of the protein, the nucleic acid and the carbohydrate.

When everything is done, write your group member’s names on the drawing and have one group member who has a camera on his/her smart phone, take a photo of your drawing masterpiece. You will find an assignment on WyoCourses where you can upload a pdf of this photo. It is due before Monday at midnight. Thanks for the Flipped Friday Fun!!
 (Links to an external site.)An

Thursday, August 25, 2016

The Science Initiative Learning Actively Mentoring Program (LAMP)

The Science Initiative Learning Actively Mentoring Program (LAMP)

LAMP is a comprehensive, sustained mentoring and professional development program with an emphasis on how to best adopt active learning strategies in large-scale active learning classrooms at UW. LAMP will enable all science teaching faculty and graduate and undergraduate teachers to become trained in best practices / active learning strategies by 2022.

Twenty-two faculty members and graduate students from the SI departments participated in the 2016 Summer Institute on Active Learning in the Sciences

The 2016 Science Initiative Summer Institute (SI2) for Faculty and Graduate Students

The first annual Science Initiative Summer Institute (SI2) was held June 7th through the 12th; it was considered a massive success by mentors, faculty and graduate students alike. The diversity and collaborative nature of the group led to unprecedented articulation, collaboration and innovation beyond that anticipated/predicted. Fellows described the experience as being "transformational", "jump starting [their] active learning knowledge" and inspiring them to help other instructors. Fellows presented their plans for launching innovative curriculum during the 2016-2017 academic year and with continued LAMP support, they look forward to spreading the ripples of their revolutionized teaching and learning environments.

Elliot Hulley, Dave Anderson, Brian Leonard and John Hoberg of the Chemistry Department work together to develop instructional strategies during the 2016 Summer Institute on Active Learning in the Sciences
“For me [the Summer Institute was] really transformational”
 – Dave Anderson, Chemistry Department Head